SCOPe 2.07: Domain d1sxqa_: 1sxq A:

Lineage for d1sxqa_ (1sxq A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.1: beta-Glucosyltransferase (DNA-modifying) [53757] (1 protein)

6. Protein beta-Glucosyltransferase (DNA-modifying) [53758] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53759] (20 PDB entries)
   Uniprot P04547

8. Domain d1sxqa_: 1sxq A: [106099]
   protein/DNA complex; complexed with udp

Details for d1sxqa_

PDB Entry: 1sxq, 1.8 Å

PDB Description: BGT in complex with a 13mer DNA containing a central C:G base pair and UDP

PDB Compounds: (A:) DNA beta-glucosyltransferase

SCOPe Domain Sequences for d1sxqa_:

Sequence; same for both SEQRES and ATOM records:

>d1sxqa_ c.87.1.1 (A:) beta-Glucosyltransferase (DNA-modifying) {Bacteriophage T4 [TaxId: 10665]}
mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl

Timeline for d1sxqa_:

• d1sxqa_ first appeared in SCOP 1.69
  
• d1sxqa_ appears in SCOPe 2.06
  
• d1sxqa_ appears in the current release, SCOPe 2.08