Lineage for d1sxqa_ (1sxq A:)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) 
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
consists of two non-similar domains with 3 layers (a/b/a) each
domain 1: parallel beta-sheet of 7 strands, order 3214567
domain 2: parallel beta-sheet of 6 strands, order 321456Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (8 families) 
Family c.87.1.1: beta-Glucosyltransferase (DNA-modifying) [53757] (1 protein) Protein beta-Glucosyltransferase (DNA-modifying) [53758] (1 species) Species Bacteriophage T4 [TaxId:10665] [53759] (20 PDB entries) 
Domain d1sxqa_: 1sxq A: [106099]
Details for d1sxqa_
PDB Entry: 1sxq (more details), 1.8 Å
PDB Description: BGT in complex with a 13mer DNA containing a central C:G base pair and UDP
SCOP Domain Sequences for d1sxqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxqa_ c.87.1.1 (A:) beta-Glucosyltransferase (DNA-modifying) {Bacteriophage T4}
mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl
SCOP Domain Coordinates for d1sxqa_:
Click to download the PDB-style file with coordinates for d1sxqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sxqa_:
- d1sxqa_ is new in SCOP 1.69
- d1sxqa_ appears in SCOP 1.71
- d1sxqa_ appears in the current release, SCOPe 2.08
View in 3D
