Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (12 families) |
Family c.87.1.1: beta-Glucosyltransferase (DNA-modifying) [53757] (1 protein) |
Protein beta-Glucosyltransferase (DNA-modifying) [53758] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [53759] (20 PDB entries) Uniprot P04547 |
Domain d1sxpa_: 1sxp A: [106097] protein/DNA complex; complexed with gol, pg4 |
PDB Entry: 1sxp (more details), 2.5 Å
SCOPe Domain Sequences for d1sxpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxpa_ c.87.1.1 (A:) beta-Glucosyltransferase (DNA-modifying) {Bacteriophage T4 [TaxId: 10665]} mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl
Timeline for d1sxpa_: