Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (2 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins) duplication: consists of two domains of this fold |
Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (4 PDB entries) Uniprot P15873 |
Domain d1sxjh2: 1sxj H:127-254 [106096] Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje1, d1sxje2 complexed with adp, atg, mg |
PDB Entry: 1sxj (more details), 2.85 Å
SCOPe Domain Sequences for d1sxjh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxjh2 d.131.1.2 (H:127-254) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl qfflapkf
Timeline for d1sxjh2: