![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
![]() | Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) ![]() associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
![]() | Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
![]() | Protein Replication factor C5 [109902] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109903] (1 PDB entry) Uniprot P38251 |
![]() | Domain d1sxje1: 1sxj E:256-354 [106089] Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje2, d1sxjf1, d1sxjf2, d1sxjf3, d1sxjg1, d1sxjg2, d1sxjg3, d1sxjh1, d1sxjh2, d1sxjh3 complexed with adp, ags, mg |
PDB Entry: 1sxj (more details), 2.85 Å
SCOPe Domain Sequences for d1sxje1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxje1 a.80.1.1 (E:256-354) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kpdwiivihkltrkivkersvnsliecravlydllahcipaniilkeltfslldvetlnt tnkssiieyssvfderlslgnkaifhlegfiakvmccld
Timeline for d1sxje1: