Lineage for d1sxje1 (1sxj E:256-354)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004351Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 2004352Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 2004353Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 2004410Protein Replication factor C5 [109902] (1 species)
  7. 2004411Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109903] (1 PDB entry)
    Uniprot P38251
  8. 2004412Domain d1sxje1: 1sxj E:256-354 [106089]
    Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd1, d1sxjd2, d1sxje2, d1sxjf1, d1sxjf2, d1sxjf3, d1sxjg1, d1sxjg2, d1sxjg3, d1sxjh1, d1sxjh2, d1sxjh3
    complexed with adp, ags, mg

Details for d1sxje1

PDB Entry: 1sxj (more details), 2.85 Å

PDB Description: crystal structure of the eukaryotic clamp loader (replication factor c, rfc) bound to the dna sliding clamp (proliferating cell nuclear antigen, pcna)
PDB Compounds: (E:) Activator 1 40 kDa subunit

SCOPe Domain Sequences for d1sxje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxje1 a.80.1.1 (E:256-354) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kpdwiivihkltrkivkersvnsliecravlydllahcipaniilkeltfslldvetlnt
tnkssiieyssvfderlslgnkaifhlegfiakvmccld

SCOPe Domain Coordinates for d1sxje1:

Click to download the PDB-style file with coordinates for d1sxje1.
(The format of our PDB-style files is described here.)

Timeline for d1sxje1: