Class a: All alpha proteins [46456] (289 folds) |
Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily) core: 5 helices: bundle |
Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) associated with N-terminal domain from the AAA+ family of P-loop hydrolases |
Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins) contains an extra helix |
Protein Replication factor C2 [109900] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [109901] (1 PDB entry) Uniprot P40348 |
Domain d1sxjd1: 1sxj D:263-353 [106087] Other proteins in same PDB: d1sxja1, d1sxja2, d1sxjb1, d1sxjb2, d1sxjc1, d1sxjc2, d1sxjd2, d1sxje1, d1sxje2, d1sxjf1, d1sxjf2, d1sxjf3, d1sxjg1, d1sxjg2, d1sxjg3, d1sxjh1, d1sxjh2, d1sxjh3 complexed with adp, ags, mg |
PDB Entry: 1sxj (more details), 2.85 Å
SCOPe Domain Sequences for d1sxjd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxjd1 a.80.1.1 (D:263-353) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vphdilieivekvksgdfdeikkyvntfmksgwsaasvvnqlheyyitndnfdtnfknqi swllfttdsrlnngtnehiqllnllvkisql
Timeline for d1sxjd1: