SCOP 1.75: Domain d1swxa_: 1swx A:

Lineage for d1swxa_ (1swx A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
   multihelical; 2 layers or orthogonally packed helices

4. Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family)

5. Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (1 protein)

6. Protein Glycolipid transfer protein, GLTP [110006] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110007] (7 PDB entries)
   Uniprot Q9NZD2

8. Domain d1swxa_: 1swx A: [106075]
   complexed with hex

Details for d1swxa_

PDB Entry: 1swx, 1.65 Å

PDB Description: Crystal structure of a human glycolipid transfer protein in apo-form

PDB Compounds: (A:) glycolipid transfer protein

SCOP Domain Sequences for d1swxa_:

Sequence, based on SEQRES records:

>d1swxa_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
llkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpakf
rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
atkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvny
tatidviyemytqmnaelnykv

Sequence, based on observed residues (ATOM records):

>d1swxa_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
llkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpakf
rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
atkayemalkkyhgwivqkifqaalyaapyksdflkalskteeeclekirlflvnytati
dviyemytqmnaelnykv

Timeline for d1swxa_:

• d1swxa_ first appeared in SCOP 1.69
  
• d1swxa_ appears in SCOP 1.73
  
• d1swxa_ appears in SCOPe 2.01
  
• d1swxa_ appears in the current release, SCOPe 2.08