Lineage for d1swxa_ (1swx A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450744Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 450745Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 450746Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (1 protein)
  6. 450747Protein Glycolipid transfer protein, GLTP [110006] (1 species)
  7. 450748Species Human (Homo sapiens) [TaxId:9606] [110007] (2 PDB entries)
  8. 450749Domain d1swxa_: 1swx A: [106075]

Details for d1swxa_

PDB Entry: 1swx (more details), 1.65 Å

PDB Description: Crystal structure of a human glycolipid transfer protein in apo-form

SCOP Domain Sequences for d1swxa_:

Sequence, based on SEQRES records: (download)

>d1swxa_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens)}
llkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpakf
rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
atkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvny
tatidviyemytqmnaelnykv

Sequence, based on observed residues (ATOM records): (download)

>d1swxa_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens)}
llkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpakf
rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
atkayemalkkyhgwivqkifqaalyaapyksdflkalskteeeclekirlflvnytati
dviyemytqmnaelnykv

SCOP Domain Coordinates for d1swxa_:

Click to download the PDB-style file with coordinates for d1swxa_.
(The format of our PDB-style files is described here.)

Timeline for d1swxa_: