Lineage for d1sw7b_ (1sw7 B:)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (17 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [51354] (16 PDB entries) 
Domain d1sw7b_: 1sw7 B: [106074]
complexed with pga; mutant
Details for d1sw7b_
PDB Entry: 1sw7 (more details), 2.22 Å
PDB Description: triosephosphate isomerase from gallus gallus, loop 6 mutant k174n, t175s, a176s
SCOP Domain Sequences for d1sw7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sw7b_ c.1.1.1 (B:) Triosephosphate isomerase {Chicken (Gallus gallus)}
rkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigvaa
qncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgnsstpqqaqe
vheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefvdi
inakh
SCOP Domain Coordinates for d1sw7b_:
Click to download the PDB-style file with coordinates for d1sw7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sw7b_:
- d1sw7b_ first appeared in SCOP 1.69
- d1sw7b_ appears in SCOP 1.73
- d1sw7b_ appears in the current release, SCOPe 2.08
View in 3D
