SCOP 1.71: Domain d1sw5c_: 1sw5 C:

Lineage for d1sw5c_ (1sw5 C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (29 proteins)

6. Protein Osmoprotection protein ProX [110750] (1 species)
   functionally related to the bacterial ProX

7. Species Archaeoglobus fulgidus [TaxId:2234] [110751] (4 PDB entries)

8. Domain d1sw5c_: 1sw5 C: [106071]

Details for d1sw5c_

PDB Entry: 1sw5, 1.8 Å

PDB Description: crystal structure of prox from archeoglobus fulgidus in the ligand free form

SCOP Domain Sequences for d1sw5c_:

Sequence; same for both SEQRES and ATOM records:

>d1sw5c_ c.94.1.1 (C:) Osmoprotection protein ProX {Archaeoglobus fulgidus}
ervvigskpfneqyilanmiailleengykaevkeglggtlvnyealkrndiqlyveytg
taynvilrkqppelwdqqyifdevkkglleadgvvvaaklgfrddyalavradwaeengv
ekisdlaefadqlvfgsdpefasrpdglpqikkvygfefkevkqmeptlmyeaiknkqvd
vipayttdsrvdlfnlkileddkgalppydaiiivngntakdeklisvlklledridtdt
mralnyqydvekkdareiamsflkeqglvk

Timeline for d1sw5c_:

• d1sw5c_ first appeared in SCOP 1.69
  
• d1sw5c_ appears in SCOP 1.73
  
• d1sw5c_ appears in the current release, SCOPe 2.08