| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
| Protein Osmoprotection protein ProX [110750] (1 species) functionally related to the bacterial ProX |
| Species Archaeoglobus fulgidus [TaxId:2234] [110751] (5 PDB entries) Uniprot O29280 # AF0982 |
| Domain d1sw5b_: 1sw5 B: [106070] complexed with cl, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1sw5 (more details), 1.8 Å
SCOPe Domain Sequences for d1sw5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sw5b_ c.94.1.1 (B:) Osmoprotection protein ProX {Archaeoglobus fulgidus [TaxId: 2234]}
ervvigskpfneqyilanmiailleengykaevkeglggtlvnyealkrndiqlyveytg
taynvilrkqppelwdqqyifdevkkglleadgvvvaaklgfrddyalavradwaeengv
ekisdlaefadqlvfgsdpefasrpdglpqikkvygfefkevkqmeptlmyeaiknkqvd
vipayttdsrvdlfnlkileddkgalppydaiiivngntakdeklisvlklledridtdt
mralnyqydvekkdareiamsflkeqglvk
Timeline for d1sw5b_: