SCOPe 2.07: Domain d1sw5a_: 1sw5 A:

Lineage for d1sw5a_ (1sw5 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Osmoprotection protein ProX [110750] (1 species)
   functionally related to the bacterial ProX

7. Species Archaeoglobus fulgidus [TaxId:2234] [110751] (5 PDB entries)
   Uniprot O29280 # AF0982

8. Domain d1sw5a_: 1sw5 A: [106069]
   complexed with cl, mg

Details for d1sw5a_

PDB Entry: 1sw5, 1.8 Å

PDB Description: crystal structure of prox from archeoglobus fulgidus in the ligand free form

PDB Compounds: (A:) osmoprotection protein (proX)

SCOPe Domain Sequences for d1sw5a_:

Sequence; same for both SEQRES and ATOM records:

>d1sw5a_ c.94.1.1 (A:) Osmoprotection protein ProX {Archaeoglobus fulgidus [TaxId: 2234]}
ervvigskpfneqyilanmiailleengykaevkeglggtlvnyealkrndiqlyveytg
taynvilrkqppelwdqqyifdevkkglleadgvvvaaklgfrddyalavradwaeengv
ekisdlaefadqlvfgsdpefasrpdglpqikkvygfefkevkqmeptlmyeaiknkqvd
vipayttdsrvdlfnlkileddkgalppydaiiivngntakdeklisvlklledridtdt
mralnyqydvekkdareiamsflkeqglvk

Timeline for d1sw5a_:

• d1sw5a_ first appeared in SCOP 1.69
  
• d1sw5a_ appears in SCOPe 2.06
  
• d1sw5a_ appears in the current release, SCOPe 2.08