Lineage for d1sw5a_ (1sw5 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 494730Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 494731Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 494732Family c.94.1.1: Phosphate binding protein-like [53851] (28 proteins)
  6. 495064Protein Osmoprotection protein ProX [110750] (1 species)
    functionally related to the bacterial ProX
  7. 495065Species Archaeoglobus fulgidus [TaxId:2234] [110751] (4 PDB entries)
  8. 495066Domain d1sw5a_: 1sw5 A: [106069]

Details for d1sw5a_

PDB Entry: 1sw5 (more details), 1.8 Å

PDB Description: crystal structure of prox from archeoglobus fulgidus in the ligand free form

SCOP Domain Sequences for d1sw5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sw5a_ c.94.1.1 (A:) Osmoprotection protein ProX {Archaeoglobus fulgidus}
ervvigskpfneqyilanmiailleengykaevkeglggtlvnyealkrndiqlyveytg
taynvilrkqppelwdqqyifdevkkglleadgvvvaaklgfrddyalavradwaeengv
ekisdlaefadqlvfgsdpefasrpdglpqikkvygfefkevkqmeptlmyeaiknkqvd
vipayttdsrvdlfnlkileddkgalppydaiiivngntakdeklisvlklledridtdt
mralnyqydvekkdareiamsflkeqglvk

SCOP Domain Coordinates for d1sw5a_:

Click to download the PDB-style file with coordinates for d1sw5a_.
(The format of our PDB-style files is described here.)

Timeline for d1sw5a_: