SCOPe 2.08: Domain d1sw4b_: 1sw4 B:

Lineage for d1sw4b_ (1sw4 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Osmoprotection protein ProX [110750] (1 species)
   functionally related to the bacterial ProX

7. Species Archaeoglobus fulgidus [TaxId:2234] [110751] (5 PDB entries)
   Uniprot O29280 # AF0982

8. Domain d1sw4b_: 1sw4 B: [106068]
   complexed with cl, tma, zn
   has additional insertions and/or extensions that are not grouped together

Details for d1sw4b_

PDB Entry: 1sw4, 1.9 Å

PDB Description: crystal structure of prox from archeoglobus fulgidus in complex with trimethyl ammonium

PDB Compounds: (B:) osmoprotection protein (proX)

SCOPe Domain Sequences for d1sw4b_:

Sequence; same for both SEQRES and ATOM records:

>d1sw4b_ c.94.1.1 (B:) Osmoprotection protein ProX {Archaeoglobus fulgidus [TaxId: 2234]}
ervvigskpfneqyilanmiailleengykaevkeglggtlvnyealkrndiqlyveytg
taynvilrkqppelwdqqyifdevkkglleadgvvvaaklgfrddyalavradwaeengv
ekisdlaefadqlvfgsdpefasrpdglpqikkvygfefkevkqmeptlmyeaiknkqvd
vipayttdsrvdlfnlkileddkgalppydaiiivngntakdeklisvlklledridtdt
mralnyqydvekkdareiamsflkeqglvk

Timeline for d1sw4b_:

• d1sw4b_ first appeared in SCOP 1.69
  
• d1sw4b_ appears in SCOPe 2.07