SCOP 1.69: Domain d1sw4a_: 1sw4 A:

Lineage for d1sw4a_ (1sw4 A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (28 proteins)

6. Protein Osmoprotection protein ProX [110750] (1 species)
   functionally related to the bacterial ProX

7. Species Archaeoglobus fulgidus [TaxId:2234] [110751] (4 PDB entries)

8. Domain d1sw4a_: 1sw4 A: [106067]

Details for d1sw4a_

PDB Entry: 1sw4, 1.9 Å

PDB Description: crystal structure of prox from archeoglobus fulgidus in complex with trimethyl ammonium

SCOP Domain Sequences for d1sw4a_:

Sequence; same for both SEQRES and ATOM records:

>d1sw4a_ c.94.1.1 (A:) Osmoprotection protein ProX {Archaeoglobus fulgidus}
ervvigskpfneqyilanmiailleengykaevkeglggtlvnyealkrndiqlyveytg
taynvilrkqppelwdqqyifdevkkglleadgvvvaaklgfrddyalavradwaeengv
ekisdlaefadqlvfgsdpefasrpdglpqikkvygfefkevkqmeptlmyeaiknkqvd
vipayttdsrvdlfnlkileddkgalppydaiiivngntakdeklisvlklledridtdt
mralnyqydvekkdareiamsflkeqglvk

Timeline for d1sw4a_:

• d1sw4a_ is new in SCOP 1.69
  
• d1sw4a_ appears in SCOP 1.71
  
• d1sw4a_ appears in the current release, SCOPe 2.08