Lineage for d1sw3a_ (1sw3 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1815294Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 1815295Protein Triosephosphate isomerase [51353] (20 species)
  7. 1815318Species Chicken (Gallus gallus) [TaxId:9031] [51354] (17 PDB entries)
    Uniprot P00940
  8. 1815323Domain d1sw3a_: 1sw3 A: [106065]
    complexed with pga; mutant

Details for d1sw3a_

PDB Entry: 1sw3 (more details), 2.03 Å

PDB Description: triosephosphate isomerase from gallus gallus, loop 6 mutant t175v
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d1sw3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sw3a_ c.1.1.1 (A:) Triosephosphate isomerase {Chicken (Gallus gallus) [TaxId: 9031]}
aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv
aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl
gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtgkvatpqqa
qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv
diinakh

SCOPe Domain Coordinates for d1sw3a_:

Click to download the PDB-style file with coordinates for d1sw3a_.
(The format of our PDB-style files is described here.)

Timeline for d1sw3a_: