Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) |
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) |
Protein Triosephosphate isomerase [51353] (18 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [51354] (16 PDB entries) Uniprot P00940 |
Domain d1sw0b_: 1sw0 B: [106061] complexed with pga; mutant |
PDB Entry: 1sw0 (more details), 1.71 Å
SCOP Domain Sequences for d1sw0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sw0b_ c.1.1.1 (B:) Triosephosphate isomerase {Chicken (Gallus gallus) [TaxId: 9031]} aprkffvggnwkmngdkkslgelihtlngaklsadtevvcgapsiyldfarqkldakigv aaqncykvpkgaftgeispamikdigaawvilghserrhvfgesdeligqkvahalaegl gviacigekldereagitekvvfeqtkaiadnvkdwskvvlayepvwaigtglwatpqqa qevheklrgwlkshvsdavaqstriiyggsvtggnckelasqhdvdgflvggaslkpefv diinakh
Timeline for d1sw0b_: