SCOPe 2.07: Domain d1svxa1: 1svx A:13-168

Lineage for d1svxa1 (1svx A:13-168)

1. Root: SCOPe 2.07

2. Class k: Designed proteins [58788] (44 folds)

3. Fold k.37: Artificial ankyrin repeat proteins [83017] (1 superfamily)

4. Superfamily k.37.1: Artificial ankyrin repeat proteins [83018] (1 family)

5. Family k.37.1.1: Artificial ankyrin repeat proteins [83019] (4 proteins)

6. Protein Off7 [111552] (1 species)

7. Species Synthetic [111553] (1 PDB entry)

8. Domain d1svxa1: 1svx A:13-168 [106058]
   Other proteins in same PDB: d1svxa2, d1svxb1, d1svxb2

Details for d1svxa1

PDB Entry: 1svx, 2.24 Å

PDB Description: Crystal structure of a designed selected Ankyrin Repeat protein in complex with the Maltose Binding Protein

PDB Compounds: (A:) Ankyrin Repeat Protein off7

SCOPe Domain Sequences for d1svxa1:

Sequence; same for both SEQRES and ATOM records:

>d1svxa1 k.37.1.1 (A:13-168) Off7 {Synthetic}
dlgrklleaaragqddevrilmangadvnaadntgttplhlaaysghleivevllkhgad
vdasdvfgytplhlaaywghleivevllkngadvnamdsdgmtplhlaakwgyleivevl
lkhgadvnaqdkfgktafdisidngnedlaeilqkl

Timeline for d1svxa1:

• d1svxa1 first appeared in SCOP 1.69, called d1svxa_
  
• d1svxa1 appears in SCOPe 2.06
  
• d1svxa1 appears in the current release, SCOPe 2.08