Lineage for d1svxa_ (1svx A:)

  1. Root: SCOPe 2.01
  2. 1074148Class k: Designed proteins [58788] (44 folds)
  3. 1074768Fold k.37: Artificial ankyrin repeat proteins [83017] (1 superfamily)
  4. 1074769Superfamily k.37.1: Artificial ankyrin repeat proteins [83018] (1 family) (S)
  5. 1074770Family k.37.1.1: Artificial ankyrin repeat proteins [83019] (4 proteins)
  6. 1074788Protein Off7 [111552] (1 species)
  7. 1074789Species Synthetic [111553] (1 PDB entry)
  8. 1074790Domain d1svxa_: 1svx A: [106058]
    Other proteins in same PDB: d1svxb_

Details for d1svxa_

PDB Entry: 1svx (more details), 2.24 Å

PDB Description: Crystal structure of a designed selected Ankyrin Repeat protein in complex with the Maltose Binding Protein
PDB Compounds: (A:) Ankyrin Repeat Protein off7

SCOPe Domain Sequences for d1svxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svxa_ k.37.1.1 (A:) Off7 {Synthetic}
sdlgrklleaaragqddevrilmangadvnaadntgttplhlaaysghleivevllkhga
dvdasdvfgytplhlaaywghleivevllkngadvnamdsdgmtplhlaakwgyleivev
llkhgadvnaqdkfgktafdisidngnedlaeilqkl

SCOPe Domain Coordinates for d1svxa_:

Click to download the PDB-style file with coordinates for d1svxa_.
(The format of our PDB-style files is described here.)

Timeline for d1svxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1svxb_