Lineage for d1svxa1 (1svx A:13-168)

  1. Root: SCOPe 2.07
  2. 2598153Class k: Designed proteins [58788] (44 folds)
  3. 2598669Fold k.37: Artificial ankyrin repeat proteins [83017] (1 superfamily)
  4. 2598670Superfamily k.37.1: Artificial ankyrin repeat proteins [83018] (1 family) (S)
  5. 2598671Family k.37.1.1: Artificial ankyrin repeat proteins [83019] (4 proteins)
  6. 2598683Protein Off7 [111552] (1 species)
  7. 2598684Species Synthetic [111553] (1 PDB entry)
  8. 2598685Domain d1svxa1: 1svx A:13-168 [106058]
    Other proteins in same PDB: d1svxa2, d1svxb1, d1svxb2

Details for d1svxa1

PDB Entry: 1svx (more details), 2.24 Å

PDB Description: Crystal structure of a designed selected Ankyrin Repeat protein in complex with the Maltose Binding Protein
PDB Compounds: (A:) Ankyrin Repeat Protein off7

SCOPe Domain Sequences for d1svxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svxa1 k.37.1.1 (A:13-168) Off7 {Synthetic}
dlgrklleaaragqddevrilmangadvnaadntgttplhlaaysghleivevllkhgad
vdasdvfgytplhlaaywghleivevllkngadvnamdsdgmtplhlaakwgyleivevl
lkhgadvnaqdkfgktafdisidngnedlaeilqkl

SCOPe Domain Coordinates for d1svxa1:

Click to download the PDB-style file with coordinates for d1svxa1.
(The format of our PDB-style files is described here.)

Timeline for d1svxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1svxa2