Lineage for d1svwb_ (1svw B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110595Protein Probable GTPase EngB [89667] (2 species)
  7. 2110596Species Bacillus subtilis [TaxId:1423] [110534] (3 PDB entries)
    Uniprot P38424
  8. 2110601Domain d1svwb_: 1svw B: [106057]
    complexed with gtp, mg

Details for d1svwb_

PDB Entry: 1svw (more details), 2.8 Å

PDB Description: crystal structure of ysxc complexed with gmppnp
PDB Compounds: (B:) GTP-binding protein YsxC

SCOPe Domain Sequences for d1svwb_:

Sequence, based on SEQRES records: (download)

>d1svwb_ c.37.1.8 (B:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}
mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps
nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk
gkdeawgaikkminr

Sequence, based on observed residues (ATOM records): (download)

>d1svwb_ c.37.1.8 (B:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}
mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
tlnfyiindelhfvdvpgygfereawgrmietyittreelkavvqivdlrhapsnddvqm
yeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkkgkdeaw
gaikkminr

SCOPe Domain Coordinates for d1svwb_:

Click to download the PDB-style file with coordinates for d1svwb_.
(The format of our PDB-style files is described here.)

Timeline for d1svwb_: