SCOP 1.71: Domain d1svwa_: 1svw A:

Lineage for d1svwa_ (1svw A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Probable GTPase EngB [89667] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [110534] (3 PDB entries)

8. Domain d1svwa_: 1svw A: [106056]

Details for d1svwa_

PDB Entry: 1svw, 2.8 Å

PDB Description: crystal structure of ysxc complexed with gmppnp

SCOP Domain Sequences for d1svwa_:

Sequence, based on SEQRES records:

>d1svwa_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis}
mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps
nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk
gkdeawgaikkminr

Sequence, based on observed residues (ATOM records):

>d1svwa_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis}
mkvseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktqtl
nfyiindelhfvdvpgygfaksereawgrmietyittreelkavvqivdlrhapsnddvq
myeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkkgkdea
wgaikkminr

Timeline for d1svwa_:

• d1svwa_ first appeared in SCOP 1.69
  
• d1svwa_ appears in SCOP 1.73
  
• d1svwa_ appears in the current release, SCOPe 2.08