Lineage for d1svwa_ (1svw A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein Probable GTPase EngB [89667] (2 species)
  7. Species Bacillus subtilis [TaxId:1423] [110534] (3 PDB entries)
    Uniprot P38424
  8. Domain d1svwa_: 1svw A: [106056]
    complexed with gtp, mg

Details for d1svwa_

PDB Entry: 1svw (more details), 2.8 Å

PDB Description: crystal structure of ysxc complexed with gmppnp
PDB Compounds: (A:) GTP-binding protein YsxC

SCOPe Domain Sequences for d1svwa_:

Sequence, based on SEQRES records: (download)

>d1svwa_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}
mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps
nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk
gkdeawgaikkminr

Sequence, based on observed residues (ATOM records): (download)

>d1svwa_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}
mkvseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktqtl
nfyiindelhfvdvpgygfaksereawgrmietyittreelkavvqivdlrhapsnddvq
myeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkkgkdea
wgaikkminr

SCOPe Domain Coordinates for d1svwa_ are not available.

Timeline for d1svwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1svwb_