SCOPe 2.08: Domain d1svva_: 1svv A:

Lineage for d1svva_ (1svv A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.1: AAT-like [53384] (17 proteins)

6. Protein Low-specificity threonine aldolase [64123] (2 species)

7. Species Leishmania major [TaxId:5664] [110676] (1 PDB entry)
   Uniprot O15839

8. Domain d1svva_: 1svv A: [106054]
   complexed with unl

Details for d1svva_

PDB Entry: 1svv, 2.1 Å

PDB Description: initial stuctural analysis of leishmania major threonine aldolase

PDB Compounds: (A:) threonine aldolase

SCOPe Domain Sequences for d1svva_:

Sequence; same for both SEQRES and ATOM records:

>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]}
pysfvndysvgmhpkildlmardnmtqhagygqdshcakaarligellerpdadvhfisg
gtqtnliacslalrpweaviatqlghisthetgaieatghkvvtapcpdgklrvadiesa
lhenrsehmvipklvyisnttevgtqytkqeledisasckehglylfldgarlasalssp
vndltladiarltdmfyigatkaggmfgealiilndalkpnarhlikqrgalmakgwllg
iqfevlmkdnlffelgahsnkmaailkagleacgirlawpsasnqlfpilentmiaelnn
dfdmytveplkdgtcimrlctswateekechrfvevlkrl

Timeline for d1svva_:

• d1svva_ first appeared in SCOP 1.69
  
• d1svva_ appears in SCOPe 2.07