![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.1: AAT-like [53384] (17 proteins) |
![]() | Protein Low-specificity threonine aldolase [64123] (2 species) |
![]() | Species Leishmania major [TaxId:5664] [110676] (1 PDB entry) Uniprot O15839 |
![]() | Domain d1svva_: 1svv A: [106054] complexed with unl |
PDB Entry: 1svv (more details), 2.1 Å
SCOPe Domain Sequences for d1svva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} pysfvndysvgmhpkildlmardnmtqhagygqdshcakaarligellerpdadvhfisg gtqtnliacslalrpweaviatqlghisthetgaieatghkvvtapcpdgklrvadiesa lhenrsehmvipklvyisnttevgtqytkqeledisasckehglylfldgarlasalssp vndltladiarltdmfyigatkaggmfgealiilndalkpnarhlikqrgalmakgwllg iqfevlmkdnlffelgahsnkmaailkagleacgirlawpsasnqlfpilentmiaelnn dfdmytveplkdgtcimrlctswateekechrfvevlkrl
Timeline for d1svva_: