Lineage for d1svva_ (1svv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131287Protein Low-specificity threonine aldolase [64123] (2 species)
  7. 2131288Species Leishmania major [TaxId:5664] [110676] (1 PDB entry)
    Uniprot O15839
  8. 2131289Domain d1svva_: 1svv A: [106054]
    complexed with unl

Details for d1svva_

PDB Entry: 1svv (more details), 2.1 Å

PDB Description: Initial Stuctural Analysis of Leishmania major Threonine Aldolase
PDB Compounds: (A:) threonine aldolase

SCOPe Domain Sequences for d1svva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]}
pysfvndysvgmhpkildlmardnmtqhagygqdshcakaarligellerpdadvhfisg
gtqtnliacslalrpweaviatqlghisthetgaieatghkvvtapcpdgklrvadiesa
lhenrsehmvipklvyisnttevgtqytkqeledisasckehglylfldgarlasalssp
vndltladiarltdmfyigatkaggmfgealiilndalkpnarhlikqrgalmakgwllg
iqfevlmkdnlffelgahsnkmaailkagleacgirlawpsasnqlfpilentmiaelnn
dfdmytveplkdgtcimrlctswateekechrfvevlkrl

SCOPe Domain Coordinates for d1svva_:

Click to download the PDB-style file with coordinates for d1svva_.
(The format of our PDB-style files is described here.)

Timeline for d1svva_: