Lineage for d1svsa1 (1svs A:32-60,A:182-347)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484126Family c.37.1.8: G proteins [52592] (43 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 484551Protein Transducin (alpha subunit) [52623] (2 species)
    common fold is interrupted with an all-alpha domain
  7. 484569Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (20 PDB entries)
  8. 484570Domain d1svsa1: 1svs A:32-60,A:182-347 [106051]

Details for d1svsa1

PDB Entry: 1svs (more details), 1.5 Å

PDB Description: structure of the k180p mutant of gi alpha subunit bound to gppnhp.

SCOP Domain Sequences for d1svsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
revkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
vqfvfdavtdviiknn

SCOP Domain Coordinates for d1svsa1:

Click to download the PDB-style file with coordinates for d1svsa1.
(The format of our PDB-style files is described here.)

Timeline for d1svsa1: