Lineage for d1svka1 (1svk A:33-60,A:182-345)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484126Family c.37.1.8: G proteins [52592] (43 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 484551Protein Transducin (alpha subunit) [52623] (2 species)
    common fold is interrupted with an all-alpha domain
  7. 484569Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (20 PDB entries)
  8. 484573Domain d1svka1: 1svk A:33-60,A:182-345 [106050]

Details for d1svka1

PDB Entry: 1svk (more details), 2 Å

PDB Description: Structure of the K180P mutant of Gi alpha subunit bound to AlF4 and GDP

SCOP Domain Sequences for d1svka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svka1 c.37.1.8 (A:33-60,A:182-345) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
evkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwi
hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd
lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv
qfvfdavtdviik

SCOP Domain Coordinates for d1svka1:

Click to download the PDB-style file with coordinates for d1svka1.
(The format of our PDB-style files is described here.)

Timeline for d1svka1: