![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries) Uniprot P10824 |
![]() | Domain d1svka1: 1svk A:33-60,A:182-345 [106050] complexed with alf, gdp, mg; mutant has additional subdomain(s) that are not in the common domain |
PDB Entry: 1svk (more details), 2 Å
SCOPe Domain Sequences for d1svka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svka1 c.37.1.8 (A:33-60,A:182-345) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]} evkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwi hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv qfvfdavtdviik
Timeline for d1svka1: