Lineage for d1svka1 (1svk A:33-60,A:182-345)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448789Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 2448840Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries)
    Uniprot P10824
  8. 2448844Domain d1svka1: 1svk A:33-60,A:182-345 [106050]
    complexed with alf, gdp, mg; mutant

Details for d1svka1

PDB Entry: 1svk (more details), 2 Å

PDB Description: Structure of the K180P mutant of Gi alpha subunit bound to AlF4 and GDP
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d1svka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svka1 c.37.1.8 (A:33-60,A:182-345) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwi
hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd
lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv
qfvfdavtdviik

SCOPe Domain Coordinates for d1svka1:

Click to download the PDB-style file with coordinates for d1svka1.
(The format of our PDB-style files is described here.)

Timeline for d1svka1: