SCOPe 2.03: Domain d1svja_: 1svj A:

Lineage for d1svja_ (1svj A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
   unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432

4. Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family)

5. Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)

6. Protein Potassium-transporting ATPase B chain, KdpB [111270] (1 species)
   minimal fold of this domain:

7. Species Escherichia coli [TaxId:562] [111271] (4 PDB entries)
   Uniprot P03960 316-451

8. Domain d1svja_: 1svj A: [106049]

Details for d1svja_

PDB Entry: 1svj

PDB Description: the solution structure of the nucleotide binding domain of kdpb

PDB Compounds: (A:) Potassium-transporting ATPase B chain

SCOPe Domain Sequences for d1svja_:

Sequence; same for both SEQRES and ATOM records:

>d1svja_ d.220.1.1 (A:) Potassium-transporting ATPase B chain, KdpB {Escherichia coli [TaxId: 562]}
nrqasefipaqgvdektladaaqlasladetpegrsivilakqrfnlrerdvqslhatfv
pftaqsrmsginidnrmirkgsvdairrhveangghfptdvdqkvdqvarqgatplvvve
gsrvlgvialkdivkg

Timeline for d1svja_:

• d1svja_ first appeared in SCOP 1.69
  
• d1svja_ appears in SCOPe 2.02
  
• d1svja_ appears in SCOPe 2.04
  
• d1svja_ appears in the current release, SCOPe 2.08