SCOP 1.69: Domain d1svia_: 1svi A:

Lineage for d1svia_ (1svi A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (43 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Probable GTPase EngB [89667] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [110534] (3 PDB entries)

8. Domain d1svia_: 1svi A: [106048]

Details for d1svia_

PDB Entry: 1svi, 1.95 Å

PDB Description: crystal structure of the gtp-binding protein ysxc complexed with gdp

SCOP Domain Sequences for d1svia_:

Sequence, based on SEQRES records:

>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis}
mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps
nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk
gkdeawgaikkminr

Sequence, based on observed residues (ATOM records):

>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis}
mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrqtlnfyiindelhf
vdvpgygfakvsksereawgrmietyittreelkavvqivdlrhapsnddvqmyeflkyy
gipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkkgkdeawgaikkmi
nr

Timeline for d1svia_:

• d1svia_ is new in SCOP 1.69
  
• d1svia_ appears in SCOP 1.71
  
• d1svia_ appears in the current release, SCOPe 2.08