Lineage for d1sv6e_ (1sv6 E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2610574Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 2610575Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 2610576Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 2610577Protein 2-keto-4-pentenoate hydratase MhpD [111274] (1 species)
  7. 2610578Species Escherichia coli [TaxId:562] [111275] (1 PDB entry)
    Uniprot P77608
  8. 2610583Domain d1sv6e_: 1sv6 E: [106047]
    Structural genomics target

Details for d1sv6e_

PDB Entry: 1sv6 (more details), 2.9 Å

PDB Description: crystal structure of 2-hydroxypentadienoic acid hydratase from escherichia coli
PDB Compounds: (E:) 2-keto-4-pentenoate hydratase

SCOPe Domain Sequences for d1sv6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sv6e_ d.177.1.1 (E:) 2-keto-4-pentenoate hydratase MhpD {Escherichia coli [TaxId: 562]}
mtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgrk
vglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpatd
itfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlkn
camkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvavn
agdrfeahiegigsvaatfss

SCOPe Domain Coordinates for d1sv6e_:

Click to download the PDB-style file with coordinates for d1sv6e_.
(The format of our PDB-style files is described here.)

Timeline for d1sv6e_: