Lineage for d1sv6e_ (1sv6 E:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515151Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 515152Superfamily d.177.1: FAH [56529] (1 family) (S)
  5. 515153Family d.177.1.1: FAH [56530] (5 proteins)
  6. 515154Protein 2-keto-4-pentenoate hydratase MhpD [111274] (1 species)
  7. 515155Species Escherichia coli [TaxId:562] [111275] (1 PDB entry)
  8. 515160Domain d1sv6e_: 1sv6 E: [106047]
    Structural genomics target

Details for d1sv6e_

PDB Entry: 1sv6 (more details), 2.9 Å

PDB Description: crystal structure of 2-hydroxypentadienoic acid hydratase from escherichia coli

SCOP Domain Sequences for d1sv6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sv6e_ d.177.1.1 (E:) 2-keto-4-pentenoate hydratase MhpD {Escherichia coli}
mtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgrk
vglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpatd
itfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlkn
camkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvavn
agdrfeahiegigsvaatfss

SCOP Domain Coordinates for d1sv6e_:

Click to download the PDB-style file with coordinates for d1sv6e_.
(The format of our PDB-style files is described here.)

Timeline for d1sv6e_: