Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.1: Pointed domain [47770] (7 proteins) |
Protein Ets DNA-binding protein pokkuri (Yan) [109863] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109864] (2 PDB entries) Uniprot Q01842 42-118 |
Domain d1sv4b1: 1sv4 B:42-118 [106042] Other proteins in same PDB: d1sv4a2, d1sv4b2 |
PDB Entry: 1sv4 (more details), 2.15 Å
SCOPe Domain Sequences for d1sv4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sv4b1 a.60.1.1 (B:42-118) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg agdvlhnvlqmliiesh
Timeline for d1sv4b1: