SCOP 1.73: Domain d1sv4b_: 1sv4 B:

Lineage for d1sv4b_ (1sv4 B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (2 families)

5. Family a.60.1.1: Pointed domain [47770] (6 proteins)

6. Protein Ets DNA-binding protein pokkuri (Yan) [109863] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109864] (2 PDB entries)

8. Domain d1sv4b_: 1sv4 B: [106042]
   mutant

Details for d1sv4b_

PDB Entry: 1sv4, 2.15 Å

PDB Description: crystal structure of yan-sam

PDB Compounds: (B:) Ets DNA-binding protein pokkuri

SCOP Domain Sequences for d1sv4b_:

Sequence; same for both SEQRES and ATOM records:

>d1sv4b_ a.60.1.1 (B:) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
agdvlhnvlqmliieshsr

Timeline for d1sv4b_:

• d1sv4b_ first appeared in SCOP 1.69
  
• d1sv4b_ appears in SCOP 1.71
  
• d1sv4b_ appears in SCOP 1.75
  
• d1sv4b_ appears in the current release, SCOPe 2.08, called d1sv4b1