Lineage for d1sv4a_ (1sv4 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1737578Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1737579Family a.60.1.1: Pointed domain [47770] (7 proteins)
  6. 1737580Protein Ets DNA-binding protein pokkuri (Yan) [109863] (1 species)
  7. 1737581Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109864] (2 PDB entries)
    Uniprot Q01842 42-118
  8. 1737584Domain d1sv4a_: 1sv4 A: [106041]

Details for d1sv4a_

PDB Entry: 1sv4 (more details), 2.15 Å

PDB Description: crystal structure of yan-sam
PDB Compounds: (A:) Ets DNA-binding protein pokkuri

SCOPe Domain Sequences for d1sv4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sv4a_ a.60.1.1 (A:) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
agdvlhnvlqmliieshs

SCOPe Domain Coordinates for d1sv4a_:

Click to download the PDB-style file with coordinates for d1sv4a_.
(The format of our PDB-style files is described here.)

Timeline for d1sv4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sv4b_