| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (3 families) ![]() |
| Family a.60.1.1: Pointed domain [47770] (6 proteins) |
| Protein Ets DNA-binding protein pokkuri (Yan) [109863] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109864] (2 PDB entries) Uniprot Q01842 42-118 |
| Domain d1sv4a_: 1sv4 A: [106041] |
PDB Entry: 1sv4 (more details), 2.15 Å
SCOP Domain Sequences for d1sv4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sv4a_ a.60.1.1 (A:) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
agdvlhnvlqmliieshs
Timeline for d1sv4a_: