SCOPe 2.07: Domain d1sv1b1: 1sv1 B:204-307

Lineage for d1sv1b1 (1sv1 B:204-307)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
   4 helices; bundle, right-handed twist; right-handed superhelix

4. Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families)

5. Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein)

6. Protein Circadian clock protein KaiA, C-terminal domain [101217] (3 species)

7. Species Thermosynechococcus elongatus bp-1 [TaxId:197221] [101218] (5 PDB entries)
   Uniprot Q79V62 174-283

8. Domain d1sv1b1: 1sv1 B:204-307 [106040]
   Other proteins in same PDB: d1sv1a2, d1sv1b2
   complexed with the KaiC C-terminal peptide (Uniprot Q79V60 488-518), chains C and D

Details for d1sv1b1

PDB Entry: 1sv1

PDB Description: NMR structure of the ThKaiA180C-CIIABD complex (25-structure ensemble)

PDB Compounds: (B:) circadian clock protein KaiA

SCOPe Domain Sequences for d1sv1b1:

Sequence; same for both SEQRES and ATOM records:

>d1sv1b1 a.186.1.1 (B:204-307) Circadian clock protein KaiA, C-terminal domain {Thermosynechococcus elongatus bp-1 [TaxId: 197221]}
rmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleihvel
mdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev

Timeline for d1sv1b1:

• d1sv1b1 first appeared in SCOP 1.69, called d1sv1b_
  
• d1sv1b1 appears in SCOPe 2.06
  
• d1sv1b1 appears in the current release, SCOPe 2.08