Lineage for d1sv1b_ (1sv1 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752891Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
    4 helices; bundle, right-handed twist; right-handed superhelix
  4. 1752892Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) (S)
  5. 1752893Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein)
  6. 1752894Protein Circadian clock protein KaiA, C-terminal domain [101217] (3 species)
  7. 1752900Species Thermosynechococcus elongatus bp-1 [TaxId:197221] [101218] (5 PDB entries)
    Uniprot Q79V62 174-283
  8. 1752907Domain d1sv1b_: 1sv1 B: [106040]
    complexed with the KaiC C-terminal peptide (Uniprot Q79V60 488-518), chains C and D

Details for d1sv1b_

PDB Entry: 1sv1 (more details)

PDB Description: NMR structure of the ThKaiA180C-CIIABD complex (25-structure ensemble)
PDB Compounds: (B:) circadian clock protein KaiA

SCOPe Domain Sequences for d1sv1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sv1b_ a.186.1.1 (B:) Circadian clock protein KaiA, C-terminal domain {Thermosynechococcus elongatus bp-1 [TaxId: 197221]}
amarmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleih
velmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev

SCOPe Domain Coordinates for d1sv1b_:

Click to download the PDB-style file with coordinates for d1sv1b_.
(The format of our PDB-style files is described here.)

Timeline for d1sv1b_: