SCOP 1.69: Domain d1sv1b_: 1sv1 B:

Lineage for d1sv1b_ (1sv1 B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
   4 helices; bundle, right-handed twist; right-handed superhelix

4. Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families)

5. Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein)

6. Protein Circadian clock protein KaiA, C-terminal domain [101217] (3 species)

7. Species Thermosynechococcus elongatus bp-1 [TaxId:197221] [101218] (5 PDB entries)

8. Domain d1sv1b_: 1sv1 B: [106040]
   complexed with the KaiC C-terminal peptide (SQ Q79V60 488-518), chains C and D

Details for d1sv1b_

PDB Entry: 1sv1

PDB Description: NMR structure of the ThKaiA180C-CIIABD complex (25-structure ensemble)

SCOP Domain Sequences for d1sv1b_:

Sequence; same for both SEQRES and ATOM records:

>d1sv1b_ a.186.1.1 (B:) Circadian clock protein KaiA, C-terminal domain {Thermosynechococcus elongatus bp-1}
amarmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleih
velmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev

Timeline for d1sv1b_:

• d1sv1b_ is new in SCOP 1.69
  
• d1sv1b_ appears in SCOP 1.71
  
• d1sv1b_ appears in the current release, SCOPe 2.08, called d1sv1b1