Lineage for d1sv1b1 (1sv1 B:204-307)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
    4 helices; bundle, right-handed twist; right-handed superhelix
  4. Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) (S)
  5. Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein)
  6. Protein Circadian clock protein KaiA, C-terminal domain [101217] (3 species)
  7. Species Thermosynechococcus elongatus bp-1 [TaxId:197221] [101218] (5 PDB entries)
    Uniprot Q79V62 174-283
  8. Domain d1sv1b1: 1sv1 B:204-307 [106040]
    Other proteins in same PDB: d1sv1a2, d1sv1b2
    complexed with the KaiC C-terminal peptide (Uniprot Q79V60 488-518), chains C and D

Details for d1sv1b1

PDB Entry: 1sv1 (more details)

PDB Description: NMR structure of the ThKaiA180C-CIIABD complex (25-structure ensemble)
PDB Compounds: (B:) circadian clock protein KaiA

SCOPe Domain Sequences for d1sv1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sv1b1 a.186.1.1 (B:204-307) Circadian clock protein KaiA, C-terminal domain {Thermosynechococcus elongatus bp-1 [TaxId: 197221]}
rmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleihvel
mdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev

SCOPe Domain Coordinates for d1sv1b1 are not available.

Timeline for d1sv1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sv1b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1sv1a1, d1sv1a2