Class a: All alpha proteins [46456] (285 folds) |
Fold a.186: KaiA/RbsU domain [101214] (1 superfamily) 4 helices; bundle, right-handed twist; right-handed superhelix |
Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) |
Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein) |
Protein Circadian clock protein KaiA, C-terminal domain [101217] (3 species) |
Species Thermosynechococcus elongatus bp-1 [TaxId:197221] [101218] (5 PDB entries) Uniprot Q79V62 174-283 |
Domain d1sv1a_: 1sv1 A: [106039] complexed with the KaiC C-terminal peptide (Uniprot Q79V60 488-518), chains C and D |
PDB Entry: 1sv1 (more details)
SCOPe Domain Sequences for d1sv1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sv1a_ a.186.1.1 (A:) Circadian clock protein KaiA, C-terminal domain {Thermosynechococcus elongatus bp-1 [TaxId: 197221]} amarmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleih velmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev
Timeline for d1sv1a_: