SCOPe 2.05: Domain d1sv0d_: 1sv0 D:

Lineage for d1sv0d_ (1sv0 D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.1: Pointed domain [47770] (7 proteins)

6. Protein Modulator of the activity of Ets (MAE, CG15085-PA) [109865] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109866] (1 PDB entry)
   Uniprot Q9I7G2 94-173

8. Domain d1sv0d_: 1sv0 D: [106038]
   Other proteins in same PDB: d1sv0a_, d1sv0b_

Details for d1sv0d_

PDB Entry: 1sv0, 2.07 Å

PDB Description: crystal structure of yan-sam/mae-sam complex

PDB Compounds: (D:) modulator of the activity of Ets CG15085-PA

SCOPe Domain Sequences for d1sv0d_:

Sequence; same for both SEQRES and ATOM records:

>d1sv0d_ a.60.1.1 (D:) Modulator of the activity of Ets (MAE, CG15085-PA) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lgsdglpldprdwtradvwkwlinmavseglevtaelpqkfpmngkalclmsldmylcrv
pvggkmlyrdfrvrlaramsr

Timeline for d1sv0d_:

• d1sv0d_ first appeared in SCOP 1.69
  
• d1sv0d_ appears in SCOPe 2.04
  
• d1sv0d_ is called d1sv0d1 in SCOPe 2.06
  
• d1sv0d_ appears in the current release, SCOPe 2.08, called d1sv0d1