Class a: All alpha proteins [46456] (258 folds) |
Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) |
Family a.60.1.1: Pointed domain [47770] (6 proteins) |
Protein Modulator of the activity of Ets (MAE, CG15085-PA) [109865] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109866] (1 PDB entry) |
Domain d1sv0d_: 1sv0 D: [106038] Other proteins in same PDB: d1sv0a_, d1sv0b_ mutant |
PDB Entry: 1sv0 (more details), 2.07 Å
SCOP Domain Sequences for d1sv0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sv0d_ a.60.1.1 (D:) Modulator of the activity of Ets (MAE, CG15085-PA) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} lgsdglpldprdwtradvwkwlinmavseglevtaelpqkfpmngkalclmsldmylcrv pvggkmlyrdfrvrlaramsr
Timeline for d1sv0d_: