Lineage for d1sv0d_ (1sv0 D:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 642791Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 642792Family a.60.1.1: Pointed domain [47770] (6 proteins)
  6. 642816Protein Modulator of the activity of Ets (MAE, CG15085-PA) [109865] (1 species)
  7. 642817Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109866] (1 PDB entry)
  8. 642819Domain d1sv0d_: 1sv0 D: [106038]
    Other proteins in same PDB: d1sv0a_, d1sv0b_
    mutant

Details for d1sv0d_

PDB Entry: 1sv0 (more details), 2.07 Å

PDB Description: crystal structure of yan-sam/mae-sam complex
PDB Compounds: (D:) modulator of the activity of Ets CG15085-PA

SCOP Domain Sequences for d1sv0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sv0d_ a.60.1.1 (D:) Modulator of the activity of Ets (MAE, CG15085-PA) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lgsdglpldprdwtradvwkwlinmavseglevtaelpqkfpmngkalclmsldmylcrv
pvggkmlyrdfrvrlaramsr

SCOP Domain Coordinates for d1sv0d_:

Click to download the PDB-style file with coordinates for d1sv0d_.
(The format of our PDB-style files is described here.)

Timeline for d1sv0d_: