Class a: All alpha proteins [46456] (258 folds) |
Fold a.60: SAM domain-like [47768] (15 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) |
Family a.60.1.1: Pointed domain [47770] (6 proteins) |
Protein Ets DNA-binding protein pokkuri (Yan) [109863] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109864] (2 PDB entries) |
Domain d1sv0b_: 1sv0 B: [106036] Other proteins in same PDB: d1sv0c_, d1sv0d_ mutant |
PDB Entry: 1sv0 (more details), 2.07 Å
SCOP Domain Sequences for d1sv0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sv0b_ a.60.1.1 (B:) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg agdvlhnvlqmliieshsr
Timeline for d1sv0b_: