SCOP 1.69: Domain d1sv0b_: 1sv0 B:

Lineage for d1sv0b_ (1sv0 B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (2 families)

5. Family a.60.1.1: Pointed domain [47770] (6 proteins)

6. Protein Ets DNA-binding protein pokkuri (Yan) [109863] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109864] (2 PDB entries)

8. Domain d1sv0b_: 1sv0 B: [106036]
   Other proteins in same PDB: d1sv0c_, d1sv0d_

Details for d1sv0b_

PDB Entry: 1sv0, 2.07 Å

PDB Description: crystal structure of yan-sam/mae-sam complex

SCOP Domain Sequences for d1sv0b_:

Sequence; same for both SEQRES and ATOM records:

>d1sv0b_ a.60.1.1 (B:) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster)}
qlppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpg
agdvlhnvlqmliieshsr

Timeline for d1sv0b_:

• d1sv0b_ is new in SCOP 1.69
  
• d1sv0b_ appears in SCOP 1.71
  
• d1sv0b_ appears in the current release, SCOPe 2.08, called d1sv0b1