Lineage for d1sv0a_ (1sv0 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444235Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 444236Family a.60.1.1: Pointed domain [47770] (6 proteins)
  6. 444237Protein Ets DNA-binding protein pokkuri (Yan) [109863] (1 species)
  7. 444238Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109864] (2 PDB entries)
  8. 444239Domain d1sv0a_: 1sv0 A: [106035]
    Other proteins in same PDB: d1sv0c_, d1sv0d_

Details for d1sv0a_

PDB Entry: 1sv0 (more details), 2.07 Å

PDB Description: Crystal Structure Of Yan-SAM/Mae-SAM Complex

SCOP Domain Sequences for d1sv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sv0a_ a.60.1.1 (A:) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster)}
lppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpga
gdvlhnvlqmliieshs

SCOP Domain Coordinates for d1sv0a_:

Click to download the PDB-style file with coordinates for d1sv0a_.
(The format of our PDB-style files is described here.)

Timeline for d1sv0a_: