Lineage for d1sv0a1 (1sv0 A:43-118)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1998616Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1998617Family a.60.1.1: Pointed domain [47770] (7 protein domains)
  6. 1998618Protein Ets DNA-binding protein pokkuri (Yan) [109863] (1 species)
  7. 1998619Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [109864] (2 PDB entries)
    Uniprot Q01842 42-118
  8. 1998620Domain d1sv0a1: 1sv0 A:43-118 [106035]
    Other proteins in same PDB: d1sv0a2, d1sv0b2, d1sv0c1, d1sv0c2, d1sv0d1, d1sv0d2

Details for d1sv0a1

PDB Entry: 1sv0 (more details), 2.07 Å

PDB Description: Crystal Structure Of Yan-SAM/Mae-SAM Complex
PDB Compounds: (A:) Ets DNA-binding protein pokkuri

SCOPe Domain Sequences for d1sv0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sv0a1 a.60.1.1 (A:43-118) Ets DNA-binding protein pokkuri (Yan) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lppslpsdprlwsredvlvflrfcvrefdlpkldfdlfqmngkrlclltradfghrcpga
gdvlhnvlqmliiesh

SCOPe Domain Coordinates for d1sv0a1:

Click to download the PDB-style file with coordinates for d1sv0a1.
(The format of our PDB-style files is described here.)

Timeline for d1sv0a1: