SCOPe 2.05: Domain d1suyb_: 1suy B:

Lineage for d1suyb_ (1suy B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
   4 helices; bundle, right-handed twist; right-handed superhelix

4. Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families)

5. Family a.186.1.1: Circadian clock protein KaiA, C-terminal domain [101216] (1 protein)

6. Protein Circadian clock protein KaiA, C-terminal domain [101217] (3 species)

7. Species Thermosynechococcus elongatus bp-1 [TaxId:197221] [101218] (5 PDB entries)
   Uniprot Q79V62 174-283

8. Domain d1suyb_: 1suy B: [106034]
   complexed with the KaiC C-terminal peptide (Uniprot Q79V60 488-518), chains C and D

Details for d1suyb_

PDB Entry: 1suy

PDB Description: NMR structure of the ThKaiA180C-CIIABD complex (average minimized structure)

PDB Compounds: (B:) circadian clock protein KaiA

SCOPe Domain Sequences for d1suyb_:

Sequence; same for both SEQRES and ATOM records:

>d1suyb_ a.186.1.1 (B:) Circadian clock protein KaiA, C-terminal domain {Thermosynechococcus elongatus bp-1 [TaxId: 197221]}
amarmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqvleih
velmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev

Timeline for d1suyb_:

• d1suyb_ first appeared in SCOP 1.69
  
• d1suyb_ appears in SCOPe 2.04
  
• d1suyb_ is called d1suyb1 in SCOPe 2.06
  
• d1suyb_ appears in the current release, SCOPe 2.08, called d1suyb1