Lineage for d1suxb_ (1sux B:)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) Protein Triosephosphate isomerase [51353] (17 species) 
Species Trypanosoma cruzi [TaxId:5693] [51358] (3 PDB entries) 
Domain d1suxb_: 1sux B: [106032]
Details for d1suxb_
PDB Entry: 1sux (more details), 2 Å
PDB Description: crystallographic analysis of the complex between triosephosphate isomerase from trypanosoma cruzi and 3-(2-benzothiazolylthio)-1- propanesulfonic acid
SCOP Domain Sequences for d1suxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1suxb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma cruzi}
askpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkf
qiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaag
fhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatp
qqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkp
efveiieatk
SCOP Domain Coordinates for d1suxb_:
Click to download the PDB-style file with coordinates for d1suxb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1suxb_:
- d1suxb_ is new in SCOP 1.69
- d1suxb_ appears in SCOP 1.71
- d1suxb_ appears in the current release, SCOPe 2.08
View in 3D
