SCOPe 2.08: Domain d1suxb_: 1sux B:

Lineage for d1suxb_ (1sux B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein Triosephosphate isomerase [51353] (21 species)

7. Species Trypanosoma cruzi [TaxId:5693] [51358] (5 PDB entries)
   Uniprot P52270

8. Domain d1suxb_: 1sux B: [106032]
   complexed with bts, so4

Details for d1suxb_

PDB Entry: 1sux, 2 Å

PDB Description: crystallographic analysis of the complex between triosephosphate isomerase from trypanosoma cruzi and 3-(2-benzothiazolylthio)-1- propanesulfonic acid

PDB Compounds: (B:) Triosephosphate isomerase, glycosomal

SCOPe Domain Sequences for d1suxb_:

Sequence; same for both SEQRES and ATOM records:

>d1suxb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma cruzi [TaxId: 5693]}
askpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkf
qiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaag
fhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatp
qqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkp
efveiieatk

Timeline for d1suxb_:

• d1suxb_ first appeared in SCOP 1.69
  
• d1suxb_ appears in SCOPe 2.07