![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) ![]() |
![]() | Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins) automatically mapped to Pfam PF00121 |
![]() | Protein Triosephosphate isomerase [51353] (21 species) |
![]() | Species Trypanosoma cruzi [TaxId:5693] [51358] (5 PDB entries) Uniprot P52270 |
![]() | Domain d1suxb_: 1sux B: [106032] complexed with bts, so4 |
PDB Entry: 1sux (more details), 2 Å
SCOPe Domain Sequences for d1suxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1suxb_ c.1.1.1 (B:) Triosephosphate isomerase {Trypanosoma cruzi [TaxId: 5693]} askpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkf qiaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaag fhvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatp qqaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkp efveiieatk
Timeline for d1suxb_: